SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE010488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE010488
Domain Number 1 Region: 84-126
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000000942
Family HSP20 0.0011
Further Details:      
 
Domain Number 2 Region: 1-37
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000000011
Family Enolase 0.0028
Further Details:      
 
Domain Number 3 Region: 40-66
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0000314
Family Enolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE010488
Sequence length 126
Comment (Oryza indica)
Sequence
MQMGSETYHHLKDIILEKYGSNSCNIGDDGGFAPNISRQANQVGTVTEAIEVVRQAKDAH
WGVMLDRSKRVLLAVENVSVNTIRFRLPENTKPEQIKASMENGVLTVTVPKEEPKKPDVK
SIQISG
Download sequence
Identical sequences OsIBCD009578 39946.BGIOSIBCE010488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]