SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE018353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE018353
Domain Number - Region: 133-172
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0798
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE018353
Sequence length 197
Comment (Oryza indica)
Sequence
MKSRGVSGSQRLTTGELGPLVRRLFHDQEKAATPAKETYKGSLATAAGVVVFHKYEAPAG
TPKTPQGERFKVFGVRNADGSYGKGLFWASTPHEKEEVAELGNSSPPHVNRHLSPPIIKE
EARKFEGSNSPQPSVTKLAKRIKQLHRENEEHRERDAERRLEIADLRNEFSLLSSALCSK
VKRTFREMEKEELYYAN
Download sequence
Identical sequences A2Y2Q4
LOC_Os05g20080.1|13105.m02126|protein OsIBCD040988 39946.BGIOSIBCE018353 39947.LOC_Os05g20080.1 LOC_Os05g20080.1|PACid:21943518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]