SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE020548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE020548
Domain Number 1 Region: 148-442
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.97e-127
Family Enolase 0.0000000049
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.53e-51
Family Enolase N-terminal domain-like 0.00000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE020548
Sequence length 446
Comment (Oryza indica)
Sequence
MAVTIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYL
GKGVLKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAV
SLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG
ASSFKEAMKMGVEVYHHLKSIIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKAAIAKA
GYTGKVVIGMDVAASEFYSEKDKTYDLNFKEDNNDGSHKISGDSLKDVYKSFVSEYPIVS
IEDPFDQDDWATYAKLTDEIGQQVQIVGDDLLVTNPTRVAKAISEKTCNALLLKVNQIGS
VTESIEAVRMSKRAGWGVMASHRSGETEDTFIADLSVGLSTGQIKTGAPCRSERLAKYNQ
LLRIEEELGDAAVYAGEKFRAPVEPY
Download sequence
Identical sequences A0A0E0A4P1 A0A0E0DWD0 A0A0E0PT68 B8B2A2 Q5VNT9
OGLUM06G02360.1 LOC_Os06g04510.1|PACid:21929811 39946.BGIOSIBCE020548 39947.LOC_Os06g04510.1 OsIBCD019318 LOC_Os06g04510.1|13106.m00409|protein XP_015643741.1.37577 OMERI06G02210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]