SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE026370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE026370
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-22
Family Cold shock DNA-binding domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 125-191
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000396
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE026370
Sequence length 193
Comment (Oryza indica)
Sequence
MASERVKGTVKWFDATKGFGFITPDDGGEDLFVHQSSLKSDGYRSLNDGDVVEFSVGSGN
DGRTKAVDVTAPGGGALSGGSRPSGGGDRGYGGGGGGGRYGGDRGYGGGYGGGDRGYGGG
GGYGGGGGGSRACYKCGEEGHMARDCSQGGGGGGGYGGGGGGYRGGGGGGGGGGCYNCGE
TGHIARECPSKTY
Download sequence
Identical sequences A2YQW2
OsIBCD043438 39946.BGIOSIBCE026370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]