SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE029136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE029136
Domain Number - Region: 177-215
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0445
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE029136
Sequence length 240
Comment (Oryza indica)
Sequence
MAGKSLIPYIGSSSNSTYNLDGEPTPANQLIPVEHYTMEGVNALWAQPLATVSGSRARIW
SPSASSLDDEKIAPPPAERYVGTLFTKAGDEVLHKYITPTATPSTPKEDRFRIQGVRTPG
GGYGKGLLQPLTASEKEGAAESRSPPPMKVKRHLMPPPIVRAAGQFQEDKVKSPEPSVHK
LAAQVKKLRKENIELRDRNTELGVELAELRNNFDTLSRGLCAKIKCAFEETGKENKYYAN
Download sequence
Identical sequences B8BD93
OsIBCD027713 39946.BGIOSIBCE029136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]