SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os01g33400.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os01g33400.1
Domain Number 1 Region: 30-85
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000484
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os01g33400.1
Domain Number - Region: 121-172
Classification Level Classification E-value
Superfamily ACT-like 0.000141
Family IlvH-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os01g33400.1
Sequence length 177
Comment (Oryza sativa)
Sequence
MAEEDNLALSVVCERSPGTAVEAASGRPPKAGSERARRQTMSRLYDELGALLPNLPPRAS
TTRIVEEAIACVGELRARTAELEAYSAVAAAAGRAARDGPAEVVASGKTSCFAVRLRAAR
ARPGALTRVLEVFQRHGVAVLAATVARDGEETAVTVTTAAVAPRVLETIKAEIICAA
Download sequence
Identical sequences A0A0E0FMA8 A0A0E0MX92 A2WQQ5 Q8LQ30
OsIBCD002015 OsIBCD002018 LOC_Os01g33400.1|13101.m03367|protein LOC_Os01g33400.1|PACid:21909258 ONIVA01G19770.1 39946.BGIOSIBCE002099 39946.BGIOSIBCE002103 39947.LOC_Os01g33400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]