SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os01g52130.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os01g52130.1
Domain Number 1 Region: 531-652
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os01g52130.1
Sequence length 666
Comment (Oryza sativa)
Sequence
MGTEAGDVDGRNHRPGRGSSASSRHLHGVGGASAAEVNLSGRRPFAEKLWSDLAETFFPD
DPFRGFGALPPARRAWCAVKYFVPALDWVPRYGLDKFKFDLLAGITIASLAIPQGISYAR
LANLPPIIGLYSSFVPPLMYAVFGSSNNLAVGTVAAASLLLASIIETEVAADENPQLYLQ
LFYTAAFFTGLFQTALGVFRLGLIVDFLSRSTITGFMGGTAMIIILQQFKGLLGMKHFTT
KTDIISVLHSTYHYRHEWKWQSAVLGICFLLFLMSSKHLRKKLPKLFWVSAIAPFMVVVI
GGIFAFLVKGDEHGIPIVGNLNKGINPLSIAQLTFQSRHMKTAVKAGLLSGILALAEGIA
VGRSLAMVKNEQIDGNKEMIAFGIMNIAGSFTSCYLTTGPFSKSAVNFHAGCKTPMSNVV
MSVCIMLVLLFLAPLFKYTPLVALSSIIVVAMIGLVKVKEFCHLYKVDKFDFCICMVAFL
GVVFFTMVAGLSASVGLSVVRALLYVARPATCKLGNIAGSETFRDVKQYPQAKSIPGILV
LQLGSPIYFVNAGYLRERILRWVEDEDNLCKSVGHDLQYLVLDLGGVTSVDNSGVGMLLE
VHKSLERRGITIALTNPRLEVTEKLVLSGYVRDILGDEWVFLTVKDAITACRYALQISRN
KGEDEV
Download sequence
Identical sequences Q942E2
39947.LOC_Os01g52130.1 XP_015625323.1.37577 LOC_Os01g52130.1|PACid:21904772 LOC_Os01g52130.1|13101.m05452|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]