SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g45580.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39947.LOC_Os03g45580.1
Domain Number - Region: 231-257
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00251
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g45580.1
Sequence length 286
Comment (Oryza sativa)
Sequence
MAVRLATATGGRGDFWAVRPGDLHRLYRQHRISRSDFDRVSHLQTANEIWNAFKNFHQGT
TKIKELRQGLFKKEYVKFEMKPGEGLDDYLGRFNKILSDLRSVDSAYDTNYSQYEISRHF
LNGLNMSIWEMKIAYIQKSVDMSTLTLDSLYIKLKTHEMNILYRKVDSNSSALVSLSTSL
DVGASSSNSIALDLINAMSDEQLEQFEEEDLALAANKISRAMNNVMYKKRGDLTCCFDCG
ALDHIRSHCPKLGRGKKKDNGGDKNKDDKPKSKSTFKGRKTKENLK
Download sequence
Identical sequences Q850S2
OsIBCD011435 LOC_Os03g45580.1|PACid:21917815 LOC_Os03g45580.1|13103.m04906|protein 39947.LOC_Os03g45580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]