SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g61090.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g61090.1
Domain Number 1 Region: 42-119
Classification Level Classification E-value
Superfamily TSP9-like 8.5e-27
Family TSP9-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g61090.1
Sequence length 119
Comment (Oryza sativa)
Sequence
MASVGFGSRVAAAGVAPSASSSSAGRRRPSRVAMAVGATRGKPAPAEEEKSLADFIFGFI
FKKDQLVETDPLLNKVDGAPPSGSTVSRKAPAKKPAASAADEEGGGGGFNLGALFAKKG
Download sequence
Identical sequences A0A0E0GVV4 A0A0E0P3D2 I1PGY3 Q94GE8
ORGLA03G0362900.1 ONIVA03G41300.1 39946.BGIOSIBCE013519 39947.LOC_Os03g61090.1 LOC_Os03g61090.1|PACid:21916269 OsIBCD039562 XP_015628859.1.37577 GO.35053 LOC_Os03g61090.1|13103.m06714|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]