SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os05g24500.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os05g24500.1
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.98e-53
Family Terpenoid cyclase N-terminal domain 0.0000535
Further Details:      
 
Domain Number 2 Region: 162-194
Classification Level Classification E-value
Superfamily Terpenoid synthases 0.0000317
Family Terpenoid cyclase C-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os05g24500.1
Sequence length 199
Comment (Oryza sativa)
Sequence
MVDKMHLVDAVQRLGIDHLFQEEISSTLSDINGSQFASNSLHEVALRFRLLRENGFWVSP
DVFKIFKGEDGRFTDAISNEPRGLLSLYNGAHLLVHDETELVEAISFSRDHLQSICDSSE
LKPPLADQVKRALDLPLPRAYKRMEALHYMFEYGQEEGHIVVLLDLAKLEFNLLQHVHLK
ELKSFSQYASFLDIYTYTK
Download sequence
Identical sequences LOC_Os05g24500.1|PACid:21939382 39947.LOC_Os05g24500.1 LOC_Os05g24500.1|13105.m02500|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]