SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os06g12690.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os06g12690.1
Domain Number 1 Region: 8-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000766
Family TAP-C domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os06g12690.1
Sequence length 250
Comment (Oryza sativa)
Sequence
MHKLGRGSRDKVQQFMTITGASEKVALQALKASDWHLEGAFDFFYSQPQISLTNSRHLED
LYNRYKEPDVDMIMVEGVSQFCTDLQVDPQDIVMLVISWHMKAATMCEFTRQEFIGGLQS
IGVDSIEKLREKLPSLRAEIKDDHKFREIYNFAFAWAREKGQKSLALETALGMWQLLFAE
RHWPLIDHWCQFLQVRHNKAISRDTWSQLLEFVKTIDPQLSNYDEEGAWPYLIDEFVEYL
TENGFVQLRK
Download sequence
Identical sequences A0A0E0DZI5 A0A0E0PVI1 A2YB06 D3U2G0 Q67UK2
39947.LOC_Os06g12690.1 LOC_Os06g12690.1|13106.m01391|protein XP_015644417.1.37577 LOC_Os06g12690.1|PACid:21933239 OMERI06G09510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]