SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399549.Msed_1596 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399549.Msed_1596
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399549.Msed_1596
Sequence length 191
Comment (Metallosphaera sedula DSM 5348)
Sequence
MDKLSVLIAGIGGQGVVTLGKIIAEAFASKGYRVFEAETHGLSQRGGAVNVHVRIGNVEA
PLIPRGGADIMIALEATEALRNVEYLSREGEIFLNASVKPPSLPKVQEYDVRMIIERLRD
WKVHVLDCNELVGKAGKCNTALLGVVYQARFSQYLERDDFLSVLRDENNRNSFLAGVRFW
ERSKEKALMTQ
Download sequence
Identical sequences A0A088E8U1 A4YH49
gi|146304359|ref|YP_001191675.1| 399549.Msed_1596 WP_012021538.1.15515 WP_012021538.1.27320 WP_012021538.1.28583 WP_012021538.1.31166 WP_012021538.1.34633 WP_012021538.1.8883 WP_012021538.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]