SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_1444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_1444
Domain Number 1 Region: 197-457
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-56
Family Pyruvate oxidase and decarboxylase Pyr module 0.058
Further Details:      
 
Domain Number 2 Region: 7-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.009
Further Details:      
 
Domain Number 3 Region: 480-587
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000131
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_1444
Sequence length 588
Comment (Staphylothermus marinus F1)
Sequence
MTTKNSVQVLFAGPAGSGNITSGLVIARALHKLGYHVIGVSEYPSLIRGGHTVYWVRAGV
EKIYELYRTSDYIVTFDEATYTRQEKDFRGDSIVVFDPDLVKRDPPRGIKYEVPMRKIIR
ENKLKPITMNMLAVGVIAGLMGLPLEEVVWSIRYQFKEKEKVAEENVKAAMYGYEYVAKH
PLPIQAYRLEPAKPWGPRILLTGNEAIGLGFVKGDLRLYVAYPMTPASPLLHFMVRVMKD
KDIPVIQAENEIAAAQMALAATWAGVRAATGTSGGGFALMNETLSEAGMLELPLIIVLAM
RPGPSTGMATHSAQEDMLYSLFAGHGEFPRIVVAPADQEDAYYRTIEALNLGWKYRVPAI
ILVDKHLAESIRSVPAFREDLSLEYGALIPKEEAEKRIEEGWEFKPYMDTETGVPPWVPP
GTKGALVKADSSEHNKKGIVTEDPVNADKQYRRRMKKEEFLRRELEEKYEVLRVYGEEPD
KTDLVILTWGSATWASLEAKKLLSKEGINLSIVQMIYLWPFPRRTFIETMKKYMDKPIVS
IEYNYRGQLGILAYMETGVKTSGHIGKVDGRPFRAEDLASKIKEFLKT
Download sequence
Identical sequences A3DPH4
399550.Smar_1444 gi|126466333|ref|YP_001041442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]