SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_1447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_1447
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-52
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_1447
Sequence length 185
Comment (Staphylothermus marinus F1)
Sequence
MLEVRWHGRGGQGAWTAANLLAMAAAYDGKYVQSFPAFGPERSGAPILAFTRISDEPIDL
HSMVYEPDMVVVLDPTLLKNVNVVSGLKKNGLIVVNYEGDTDKLYNMLGIKKGEYKVVVT
PATKLALEILKRPITNTPMIGALIKAAPIVSFESIEKAVKKRFPGPIAEKNVALIKEAYK
LAKEV
Download sequence
Identical sequences A3DPH7
399550.Smar_1447 gi|126466336|ref|YP_001041445.1| WP_011839731.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]