SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399599.Sbal195_0490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  399599.Sbal195_0490
Domain Number - Region: 99-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00222
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 399599.Sbal195_0490
Sequence length 156
Comment (Shewanella baltica OS195)
Sequence
MEFSNPILVWAVVGLVFMLAEIVVPGGIIVLLGAACLVVAGALAIGLVEGVVQSMTLWFI
SAIVLLLAFRQVTQRLVGGDSHVDNTDEAIDLYNQIVRVKQTIGPGQTPGRVEFQGSEWP
ALGDGTTIAAGTEVRIICRENIALVVEPISIEASKN
Download sequence
Identical sequences A9KYS4 G0AVP2
gi|386323038|ref|YP_006019155.1| gi|152999019|ref|YP_001364700.1| 399599.Sbal195_0490 402882.Shew185_0469 gi|160873612|ref|YP_001552928.1| gi|378706852|ref|YP_005271746.1| WP_006083285.1.19221 WP_006083285.1.35668 WP_006083285.1.60405 WP_006083285.1.76213 WP_006083285.1.85636 WP_006083285.1.93117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]