SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399726.Teth514_0127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399726.Teth514_0127
Domain Number 1 Region: 94-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.13e-79
Family D-glucarate dehydratase-like 0.0000289
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.11e-26
Family Enolase N-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 399726.Teth514_0127
Sequence length 381
Comment (Thermoanaerobacter X514)
Sequence
MKITSLKVYKVKPRWIFLKIDTDEGISGWGELISGTKTETVVAGAYEMGEYLIDKDPRQI
EDMWQVIYRSFFRGGPINMTILSGIEMALWDIKGKYYNMPVYEFLGGKARDKIMVYSWIG
GDRPSDVVEAALDRKNKGFKAIKMNATEELHYIDSYKKIEAVIERVASIRDAVGYEMEIG
IDFHGRVHKAMAKVLAKELEKYRPMFIEEPVLPENNEALKEIASYTSIPIATGERLYTRW
GFKDVLKSGVVDIIQPDVALTGGILEAKKISAMAEAFDVAVAPHAPYGPIALAATLQLDI
CTPNVFIQEQSLGIHYNQGFDLLDFVKNKEIFAYKDGFVDIPTGPGLGIEIDEELVKKVD
MEGLHWTNPKWRNYDGTVAEW
Download sequence
Identical sequences A0A101D9F3 A0A101FED8 B0K1J0 C7ITW6
399726.Teth514_0127 gi|307723370|ref|YP_003903121.1| WP_003868265.1.26562 WP_003868265.1.47445 WP_003868265.1.81593 WP_003868265.1.95568 gi|167038800|ref|YP_001661785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]