SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399726.Teth514_1310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399726.Teth514_1310
Domain Number 1 Region: 138-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.84e-131
Family Enolase 0.00000000641
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-62
Family Enolase N-terminal domain-like 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399726.Teth514_1310
Sequence length 429
Comment (Thermoanaerobacter X514)
Sequence
MSSIIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYL
GKGVLKAVQNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAK
AAAEECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALR
MCSEVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGEDIVLA
LDPAATEMYKEDGKYHFEGEGIVRTSAEMVDFWEQLVNKYPIVSIEDGLAEEDWNGWKLL
TERLGKKIQLVGDDLFVTNTQRLSKGISMGVANSILIKLNQIGTLTETLDAIEMAKRAGY
TAVVSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVAKYNQLLRIEEVLGSTAQYLG
KNAFYNIKK
Download sequence
Identical sequences A0A101D7K8 A0A117LAW2 B0K6X6
WP_009053020.1.26562 WP_009053020.1.81593 WP_009053020.1.95568 gi|167039953|ref|YP_001662938.1| gi|307724723|ref|YP_003904474.1| 399726.Teth514_1310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]