SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399726.Teth514_1572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399726.Teth514_1572
Domain Number 1 Region: 15-196
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-26
Family Clp protease, ClpP subunit 0.088
Further Details:      
 
Domain Number 2 Region: 370-431
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000116
Family NfeD domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399726.Teth514_1572
Sequence length 436
Comment (Thermoanaerobacter X514)
Sequence
MRSRVGTFVIFLITALLFFSLFTNVSGLPKEKGEVLFVPIRGTVDPGMAKFVKRAVEEAK
ETEAALLVFEINTPGGLVDAAVEISQTILNSPVPTAAYVNSQATSAGVLIAISCENLYMA
PGSTIGAAETVPKEEKTISYWRSKLEGAAERRGRDPRIVAAMADADVEIEGLKERGKILS
LTDKKALELKLADGIAADRKELLTVLGVGDRDVKEVKPFFSERIASFVTSPFVAPMFLTI
GFIGIITEVLTPGFGAPGLIGIISLVLFFAGHMIAELAGWESVIFFLAGLILLTVEALMP
GFGVFGLLGITGIITGIVTASATVKQGLITVTISMVVSMVILAFLIRRLARSPLFDRLVL
FSRLDKSSGYSATEERHELIGRTGVTITPLRPAGIADFDGIKLDVVSDGKFIEAGERVRV
VRVEGIRIVVDQDSLK
Download sequence
Identical sequences B0K164
gi|167040210|ref|YP_001663195.1| gi|307724470|ref|YP_003904221.1| WP_009052351.1.26562 WP_009052351.1.81593 WP_009052351.1.95568 399726.Teth514_1572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]