SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399739.Pmen_0471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399739.Pmen_0471
Domain Number 1 Region: 47-231
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.73e-27
Family Clp protease, ClpP subunit 0.023
Further Details:      
 
Domain Number 2 Region: 403-472
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000798
Family NfeD domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399739.Pmen_0471
Sequence length 481
Comment (Pseudomonas mendocina ymp)
Sequence
MLRKGPPPRVRYQCGSRESNVLPGWLRLCLCALILCASVGVSAAPGAVVQLQVDGVIGPA
SADYLVRGLAKAVDEGAQLVVIEIDTPGGLDTAMRAIIKAILASPIPVASYVAPGGARAA
SAGTYILYASHVAAMTPGTNLGAATPVAIGMPGAPSQPEGDDKGEKDKATQGDKGTGDAM
TAKQVNDAAAYIRGLANMRGRNAEWAEQAVREAVSLSAEEALEQKVIDYLARDTADLLRQ
LDGKTLQAAGVELTLATAGAPLISHAPDWRTRLLAVITNPSVALILMMIGVYGLFFEFSN
PGSGVGGVLGGISLVLALYALQLLPVNYAGVALILLGIAFITAEAFLPSFGVLGIGGVVA
FVFGGLILIDTDVPGFGIPLALIITLALVSAALILAIVGMALRARRRQQVAGDSGLVGSL
VAIAAVREDDPRAGWVALQGERWQVQGAAPLQPGQQVRVTAREGVHLQVSAVDEPPPRGG
N
Download sequence
Identical sequences A4XPH5
399739.Pmen_0471 gi|146305508|ref|YP_001185973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]