SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399739.Pmen_0948 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399739.Pmen_0948
Domain Number 1 Region: 461-560
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.81e-16
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399739.Pmen_0948
Sequence length 579
Comment (Pseudomonas mendocina ymp)
Sequence
MSRPSLPLFAAWRQTLRAGYSWKALRGDLSAGLTVGIIAIPLAMALAIAVGVAPQHGLYT
VLIAAPLIALCGGSRFNISGPTAAFVVILLPITQQYGLGGLLLCTLMAGLILISLGLLRA
GRLIEFVPYPVTLGFTAGIGIVIAILQIKDLFGLHLAGAPQHLLEQVNLLVRALPGLQPG
DTLVGLACLTTLLIWPRLMPKIPAHLVALAVGALLALALERLGLPVATLGERFTYQLDGI
EHPGIPPFLPSLALPWSLPGADGQPLVVSFELIRQLLAPAFAIAMLGAIESLLCAVVADG
MTGSKHDPNAELIGQGLGNLAAPFFGGITATAAIARTAANVRAGAFSPVAALVHAGVVLA
AILLLAPLFSYLPMAALAALLLMVAWNMSEPHHVAHTLRIAPRSDVLVLLTCLVLTVLFD
MVLAVGVGLLLAAGLFIKRMSELTDTAALNRQQREALQDLPEHVLAYAIRGPLFFGAAEK
ALSVLRRFTPGVKVVVVDISAVPLLDMTALAALDNVLRDYRQQGVALILSGPTAQVRLQL
RRAGVQRREGELAYVRDLPQAREKALRWLEASPDTQHAM
Download sequence
Identical sequences A4XQV0
gi|146305983|ref|YP_001186448.1| WP_011921042.1.24137 399739.Pmen_0948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]