SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399739.Pmen_4304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  399739.Pmen_4304
Domain Number - Region: 29-98
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000432
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 
Domain Number - Region: 104-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00602
Family NfeD domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399739.Pmen_4304
Sequence length 149
Comment (Pseudomonas mendocina ymp)
Sequence
MIHYLQHLSFWDWLALATVLLILEVFGAGGYLLWIGLAAACVGVLTYLFPELPWVWQFFL
FGLLAILTAVVWWRRQRSMLRPSDQPGLNRRGSELLGRRFALHEPIVGGRGKIKAGDSLW
LVSGPDLPVGSQVKVVAQDGVILRVEQDA
Download sequence
Identical sequences A0A291K0V1 A4Y0D5
gi|146309318|ref|YP_001189783.1| WP_003242420.1.24137 WP_003242420.1.32543 399739.Pmen_4304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]