SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_1152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_1152
Domain Number 1 Region: 93-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000667
Family NfeD domain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  399741.Spro_1152
Domain Number - Region: 31-82
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000981
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_1152
Sequence length 153
Comment (Serratia proteamaculans 568)
Sequence
MLEQIAANPHWFWLSLGGLLLAAEMLGASGYLLWSGVSAVVVGAIVWLLPQLAWEWQGVI
FAVLTVVVAYLWWYWLRQRPAAASSGSQVLNQRNRQLIGTRATLTEPMHNGMGRINIGDS
SWRAQASEDLAVGTEVEVIAVEGITLVIRAIAR
Download sequence
Identical sequences A8GAW6
WP_012005591.1.18676 WP_012005591.1.35080 399741.Spro_1152 gi|157369395|ref|YP_001477384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]