SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_1502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  399741.Spro_1502
Domain Number - Region: 77-150
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0209
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_1502
Sequence length 195
Comment (Serratia proteamaculans 568)
Sequence
MKKITLALAIISAFAAVSTAQAADVTAQALATWSATAKKDTTSKLVVTPIGSLSFNYAEG
IKGFNSQKGLFDVTVEGDATATAFKLTSKLVSNTLTQLDTSGSTLNVGVNYNGEAVEKTA
ETTMIDTSAGILGGNLSALSNAYNKAVRTSAQDQFTFTIIGATSDGTTAVTDFSTLPEGI
WSGDVSVEFNATWTA
Download sequence
Identical sequences A8GBW6
399741.Spro_1502 WP_012005935.1.18676 WP_012005935.1.35080 gi|157369745|ref|YP_001477734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]