SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_1983 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_1983
Domain Number 1 Region: 390-474
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000169
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_1983
Sequence length 509
Comment (Serratia proteamaculans 568)
Sequence
MFNLNNFRLSTVKNEVLAGFVVAVSMIPEAVGFSLVAGLSPIVGLHTAFIIGLVTALFGG
KPGMVSGAAGSIVVVLMSLAAQHGMAYVLWATIFAGVIQILIGVFRLGKFIRLVPLPAIH
GFVNGLAIVIMLAQLHMIAGQGLLMYGLVALAIGVVVLFPRLTRVIPASLAALIVVSALA
IGFNLHTLRVGDLADISGALPHFSLPMAPFSLEMLKVVLPYAVVIALVGLIESLLTMTVL
DEMGGKKGNGNRESIAQGAGNAICGLFGCFAGCAMIGQSIINFTSGGRGRISGVVGAILL
ILFVVSLSGYIGLLPVAALAGVMLVVCYNTFEWSSLRRLRRMPKADALVMLLVTVITIFT
DLAMAVISGVIISALVFAWQQARIRVRQHQVEGDVAVYQLDGPLFFGSTTAFAELFEPKN
DPQNVVLDFAGTRVMDSSGVEAIDKLTARYLAAGKTIRLRHLSGDCVRLLKQAGPFCSHE
LDDPQYYVAEEGYQTDDANVGEETFKLRT
Download sequence
Identical sequences A8GD96
WP_012006407.1.35080 gi|157370225|ref|YP_001478214.1| 399741.Spro_1983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]