SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_2248 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_2248
Domain Number 1 Region: 12-171
Classification Level Classification E-value
Superfamily Regulatory protein AraC 3.14e-31
Family Regulatory protein AraC 0.00000358
Further Details:      
 
Domain Number 2 Region: 236-286
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000013
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 3 Region: 182-232
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000762
Family Tetracyclin repressor-like, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_2248
Sequence length 305
Comment (Serratia proteamaculans 568)
Sequence
MYHRMAQEPQPNPLLPGYTFNAYLVAGLTPIMADGPLDFFIDRPGGMKGYILNLTIKGQG
KVFDGEDTLYCNPGDLLLFPPKAAHYYGRSPDSDCWYHRWVYFRPRAYWADWLEWHSKTH
EVGRLTLPNNNLLLEFDRLFANIEQTQRSGRRFAEELGMNLLERLLLRAMEEDPLSPQKI
MDPRVIEACQFITGNLAGELRIDEVARHVCLSPSRLAHLFREQVGINILRWREDQRVIRA
KLLLQTTQESIATIGRVVGYDDQLYFSRVFRKRVGVSPSDFRRRSLEINYPARNQREQPY
VAASS
Download sequence
Identical sequences A8GE09
399741.Spro_2248 gi|157370488|ref|YP_001478477.1| WP_012144978.1.18676 WP_012144978.1.35080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]