SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_3563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_3563
Domain Number 1 Region: 98-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.06e-79
Family D-glucarate dehydratase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.09e-33
Family Enolase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_3563
Sequence length 404
Comment (Serratia proteamaculans 568)
Sequence
MKIINAEVFVTCPGRNFVTLKITTDEGITGIGDATLNGRELPVASYLKDHVCPQLIGRDA
HQIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKGKAANMPLYQLLGGASRTGVMVY
CHTTGHSIDEVLDDYAKHKELGFKAIRAQCGVPGMKTTYGMAKGKGLAYEPATKGNWPEE
QLWSTEKYLDFTPKLFEAVRNRFGFDEHLLHDMHHRLTPIEAARFGKSIEQYRLFWMEDP
TPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWSFN
DGYMHPGNKPGLGIEFDEKLAARYPYEPAYLPVARLEDGTLWNW
Download sequence
Identical sequences A8GHR9
399741.Spro_3563 gi|157371798|ref|YP_001479787.1| WP_012146272.1.18676 WP_012146272.1.35080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]