SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399742.Ent638_0964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399742.Ent638_0964
Domain Number 1 Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000929
Family NfeD domain-like 0.0049
Further Details:      
 
Weak hits

Sequence:  399742.Ent638_0964
Domain Number - Region: 31-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000157
Family LacY-like proton/sugar symporter 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399742.Ent638_0964
Sequence length 150
Comment (Enterobacter 638)
Sequence
MIEMMVAHPHVFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLLVWLLPFGWEWQGALF
AVLTLVAAWLWWRWLNRQVRNQKPANAALNQRGQQLMGKRYTLDDTLINGRGHVRIGDSS
WPVVADDDLVAGTRVEVIAVEGITLRVKAC
Download sequence
Identical sequences A4W7G8
gi|146310625|ref|YP_001175699.1| 399742.Ent638_0964 WP_012016368.1.55209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]