SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400667.A1S_2757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400667.A1S_2757
Domain Number 1 Region: 48-112
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000641
Family NfeD domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 400667.A1S_2757
Sequence length 116
Comment (Acinetobacter baumannii ATCC 17978)
Sequence
MVCFLYWLFPDISLTTQIVLWIVLSVLCTLLWFKFIKPLSIDKTKAGLPREATIGQIGMV
IQTGLTHDQIIVRFPMPILGADEWNCRSTTPVKVGDRVRVIDISGNDLIVQPHSTS
Download sequence
Identical sequences gi|126642788|ref|YP_001085772.1| 400667.A1S_2757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]