SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400668.Mmwyl1_1299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400668.Mmwyl1_1299
Domain Number 1 Region: 144-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.9e-127
Family Enolase 0.00000000127
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.37e-56
Family Enolase N-terminal domain-like 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 400668.Mmwyl1_1299
Sequence length 433
Comment (Marinomonas MWYL1)
Sequence
MSQIVDIKAREVLDSRGNPTVEADVILADGSVGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVAAVNGPIRDALIGKDALAQAEIDHIMIDLDGTENKSTFGANAILAVSLAVAK
AAAISKKVPLYAHIADINGTPGVYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAPNFR
EALRYGAEIFHALKKVLSDRGLSTAVGDEGGFAPDLSSNAEALAVIKEAVAAAGYELGKD
ITLAMDCAASEFYDKEANIYDLKGEGKKFTSEEFNFFLQDLTKQYPIVSIEDGLDESDWD
GFAHQTKLMGDKIQLVGDDLFVTNTKILQRGIDNGIANSILIKFNQIGSLTETLAAIKMA
KDAGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEQLGGK
APYKGRSEIKGQA
Download sequence
Identical sequences A6VUU9
gi|152995328|ref|YP_001340163.1| WP_012069013.1.45605 400668.Mmwyl1_1299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]