SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400668.Mmwyl1_1846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  400668.Mmwyl1_1846
Domain Number - Region: 117-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00366
Family NfeD domain-like 0.0076
Further Details:      
 
Domain Number - Region: 24-83
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0523
Family Rhomboid-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 400668.Mmwyl1_1846
Sequence length 153
Comment (Marinomonas MWYL1)
Sequence
MDIIANNLAQSLFIVGLILLVIEVAVLGFSTFVLFFVGLAAMTTGALVYVGVLPNSLLSA
SFSTGVMTVLAALVLWKPLKRMQSKVSTKKAKSEFTDHQFYLKEAVSPTQSPKYHYSGIE
WSLVSEEPIEAGTKVEVTEAEVGKLHIKAISSK
Download sequence
Identical sequences A0A1M5JVJ5 A6VWE1
WP_012069549.1.21196 WP_012069549.1.45605 400668.Mmwyl1_1846 gi|152995870|ref|YP_001340705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]