SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400673.LPC_1523 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400673.LPC_1523
Domain Number 1 Region: 139-409
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.97e-125
Family Enolase 0.0000000425
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.99e-52
Family Enolase N-terminal domain-like 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 400673.LPC_1523
Sequence length 422
Comment (Legionella pneumophila Corby)
Sequence
MHIHKIQAREILDSRGNPTIEADVILTTGIIGRASVPSGASTGSREACELRDNDPKRYAG
KGVQKAVKHVNNEINQALQGLSVEDQENLDRILCQLDNTENKSHLGANAILATSLACARA
RALSLNQPLYMTLNQGDMMTMPVPMMNILNGGAHADNNVDIQEFMIMPIGAPDFPVALQM
GTEIFHVLKSVLKKQGLNTAVGDEGGFAPNIQSNRQALDLLSEAIEKAGFRLGEDIVFAL
DVAASELFNEGFYHMYSENQKFDSHQLIEYYANLISSYPIVSIEDGLDEKDWSGWKQLTT
HLGNKVQLVGDDLFVTNPKILREGIAQGVANAILIKVNQIGTLSETRQAIKLAYDNGYRC
VMSHRSGETEDTFIADLAVASGCGQIKTGSLCRTDRTAKYNQLLRINELASLPYAGKNIL
KR
Download sequence
Identical sequences A5IDM2
WP_011946936.1.29425 WP_011946936.1.31301 WP_011946936.1.50792 gi|148359611|ref|YP_001250818.1| 400673.LPC_1523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]