SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400673.LPC_2342 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400673.LPC_2342
Domain Number 1 Region: 226-482
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-57
Family Pyruvate oxidase and decarboxylase Pyr module 0.044
Further Details:      
 
Domain Number 2 Region: 9-209
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000000000445
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 3 Region: 500-597
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000852
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 400673.LPC_2342
Sequence length 605
Comment (Legionella pneumophila Corby)
Sequence
MSTTDVIVVRITGDSGDGVQLVGEQLTISAALTGRDVRTMPDFPAEIRAPAGTVAGVSGF
QLAMAERAIFTAGESLDVLVALNPAALKNSLQHLNQGGLLIINEDSFQERDWQKAGIDKS
FLDNCREHYHIVAFPLITQTIQAVESINLTKPQAVKTKNFYILGLVLWLFDLPTETCQAF
IAKKFKTNQAIAKANELALLAGYNYAMTLELSRRDYMLGEVNRHSGEYRQITGVEAVGLA
LATLATQTQVPLLVSGYPITPASAILHECVRLSDYGVQLIQAEDEIAAICSCIGAAYGGR
LALTCTSGPGLDLKCESLGLAVVTELPLVLVDVQRAGASTGLPTKTSQSDLKQALYGRHG
EAPLPVIAAQSPADCFNTIIEAFRIAIKYMTPVIVLLDAYLANAAEPWEIPALDSLNIPK
PEFNRFTKPYHRDEFLSRSWNVPGTSGFIHQIGGLEKQGDEGRVSYDAENHQKMVITRAE
KIKGIARDYPALVLEGDMTAPTLVIGWGSTFGSLKSAVHQCLEQGLPVAYLHLRHLNPLP
DDLGSLLKKYDKVLVAELNSGQLCQLIRAVYLVDAQSISQCNGQPFSVNHLVSAIKAEAN
YEQQL
Download sequence
Identical sequences A0A1P8N4R6 A0A1S8GLQ9
WP_011946037.1.10632 WP_011946037.1.1206 WP_011946037.1.16040 WP_011946037.1.16626 WP_011946037.1.17430 WP_011946037.1.17681 WP_011946037.1.24659 WP_011946037.1.24881 WP_011946037.1.25619 WP_011946037.1.27676 WP_011946037.1.2872 WP_011946037.1.29425 WP_011946037.1.29598 WP_011946037.1.31301 WP_011946037.1.32367 WP_011946037.1.32970 WP_011946037.1.34167 WP_011946037.1.34246 WP_011946037.1.34671 WP_011946037.1.35792 WP_011946037.1.36520 WP_011946037.1.37078 WP_011946037.1.37616 WP_011946037.1.37757 WP_011946037.1.37792 WP_011946037.1.38444 WP_011946037.1.40151 WP_011946037.1.41585 WP_011946037.1.41639 WP_011946037.1.43145 WP_011946037.1.45368 WP_011946037.1.47329 WP_011946037.1.49404 WP_011946037.1.50792 WP_011946037.1.51024 WP_011946037.1.51991 WP_011946037.1.52439 WP_011946037.1.5252 WP_011946037.1.52911 WP_011946037.1.53134 WP_011946037.1.53261 WP_011946037.1.5363 WP_011946037.1.55083 WP_011946037.1.56801 WP_011946037.1.58590 WP_011946037.1.59692 WP_011946037.1.6043 WP_011946037.1.60442 WP_011946037.1.61570 WP_011946037.1.62386 WP_011946037.1.62610 WP_011946037.1.65444 WP_011946037.1.6641 WP_011946037.1.6663 WP_011946037.1.66949 WP_011946037.1.67503 WP_011946037.1.72722 WP_011946037.1.7313 WP_011946037.1.74052 WP_011946037.1.76246 WP_011946037.1.7695 WP_011946037.1.77227 WP_011946037.1.77695 WP_011946037.1.77829 WP_011946037.1.78899 WP_011946037.1.79209 WP_011946037.1.80246 WP_011946037.1.80679 WP_011946037.1.80844 WP_011946037.1.80921 WP_011946037.1.82012 WP_011946037.1.83114 WP_011946037.1.84649 WP_011946037.1.86462 WP_011946037.1.87225 WP_011946037.1.88749 WP_011946037.1.93995 WP_011946037.1.9568 WP_011946037.1.98163 WP_011946037.1.98841 WP_011946037.1.99113 WP_011946037.1.99767 WP_011946037.1.9980 WP_011946037.1.99939 gi|296106530|ref|YP_003618230.1| 400673.LPC_2342 gi|148360403|ref|YP_001251610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]