SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 400673.LPC_2710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400673.LPC_2710
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily GlnB-like 2.03e-44
Family Prokaryotic signal transducing protein 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 400673.LPC_2710
Sequence length 112
Comment (Legionella pneumophila Corby)
Sequence
MKMITAIIKPFKLDDVHEALMEIGVPGITISETRGFGRQKGHTELYRGAEYVVDFLPKIK
IELALPDNMVEAAIEAICKSAYTGKIGDGKIFVYALEQVVRVRTGEVGTDAL
Download sequence
Identical sequences A0A128LAG2 Q5WYV9
gi|148360760|ref|YP_001251967.1| gi|54296611|ref|YP_122980.1| gi|397666266|ref|YP_006507803.1| 297245.lpl0626 297246.lpp0642 400673.LPC_2710 gi|54293574|ref|YP_125989.1| WP_011213200.1.100653 WP_011213200.1.14160 WP_011213200.1.14762 WP_011213200.1.22644 WP_011213200.1.31669 WP_011213200.1.33239 WP_011213200.1.36691 WP_011213200.1.39047 WP_011213200.1.41771 WP_011213200.1.52625 WP_011213200.1.58394 WP_011213200.1.64624 WP_011213200.1.66871 WP_011213200.1.69425 WP_011213200.1.74594 WP_011213200.1.80998 WP_011213200.1.86175 WP_011213200.1.90390 WP_011213200.1.94448 WP_011213200.1.94812 WP_011213200.1.96607 WP_011213200.1.97854 WP_011213200.1.99517 gi|509149917|ref|YP_008062291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]