SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400673.LPC_3273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400673.LPC_3273
Domain Number 1 Region: 72-260
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.63e-29
Family Clp protease, ClpP subunit 0.017
Further Details:      
 
Domain Number 2 Region: 432-495
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000654
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 400673.LPC_3273
Sequence length 501
Comment (Legionella pneumophila Corby)
Sequence
MHRDCVRQEGLYKLNNLFCKWAAVIRGLQGIIFRSRLSVSVLEDSDSVATKQSQLSVTCE
MKLSKFMQTSCIFIFLTLFLLVGLQTSFAAKIVELNIKGPIGPATADYLERGIKSAQDAD
LIVILIDTPGGLYDSTRNIIQLFLLSDVPIVTYVSPTGARAASAGTYLMYASTLAAMAPG
TQMGAASPVSLGTGFSEGEKDEKKKSTMENKVTHDAVATIRSLAQLRGRDPDFAEKAVTE
GKSITANEALSKGVVNYIAKNRDDLLSQIHGIKVSQNNKTITINTESPDIQVINPDWRTR
FLSVITNPTVAYLLLLLGIYGIFFELVNPGYVLPGVVGAVSMLFALYALQLLPINYAGLG
LIILGILFVIAEAFTPSFGALGVGGTVSFILGSIMLMNTEHLAFQIAWSAIWAMAVLNIL
IFVLVLGMLIKSRNQKIRHGLETLVGAKGRALGDINLEGQAVIKGEIWNVHSSSPIAANK
SVKVTRASGLLLEVEEDQSVY
Download sequence
Identical sequences A0A128W342 A0A1S8GG42
gi|148361299|ref|YP_001252506.1| 400673.LPC_3273 WP_011947859.1.10632 WP_011947859.1.21168 WP_011947859.1.24659 WP_011947859.1.2872 WP_011947859.1.28782 WP_011947859.1.29425 WP_011947859.1.32367 WP_011947859.1.37078 WP_011947859.1.47725 WP_011947859.1.50792 WP_011947859.1.5363 WP_011947859.1.63686 WP_011947859.1.6641 WP_011947859.1.68780 WP_011947859.1.72722 WP_011947859.1.79331 WP_011947859.1.93995 WP_011947859.1.98579 WP_011947859.1.98841 WP_011947859.1.99481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]