SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 401473.BDP_0870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  401473.BDP_0870
Domain Number 1 Region: 139-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.15e-118
Family Enolase 0.0000000627
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.83e-53
Family Enolase N-terminal domain-like 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 401473.BDP_0870
Sequence length 432
Comment (Bifidobacterium dentium Bd1)
Sequence
MAVIESVYARQILDSRGNPTVEVVLDTEDGAQGLGLVPSGASTGEAEAWERRDGDKSVYM
GKGVLNAVKAVNEEIAPKVIGMDASDQRALDEVMIELDGTPNKGRLGANAILGVSLAALY
ASAESTGQPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQEYMISPYGFDTYSEALR
AGVEVYHTLKNVLKKEGLATGLGDEGGFAPKMKSNKDSLNYIMDAISAAGYEPGKQIGIS
LDVASSEFYNKETGKYHFEGDDREAGYMLDFYENLINEYPIVSIEDPFQEEGWEDWAAIT
AKLGDRLQFVGDDLLVTNPARLAKGIELGAANSLLVKLNQIGTVTETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAQYAGY
SAFKACKKYIAK
Download sequence
Identical sequences D2Q9N9 W2VI16
WP_003840619.1.11892 WP_003840619.1.14814 WP_003840619.1.2424 WP_003840619.1.39260 WP_003840619.1.42327 WP_003840619.1.53636 WP_003840619.1.91619 gi|283455785|ref|YP_003360349.1| 401473.BDP_0870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]