SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402626.Rpic_0972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402626.Rpic_0972
Domain Number 1 Region: 139-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.69e-130
Family Enolase 0.0000000112
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.61e-56
Family Enolase N-terminal domain-like 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 402626.Rpic_0972
Sequence length 427
Comment (Ralstonia pickettii 12J)
Sequence
MSAIVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYL
GKGVLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKSRLGANAMLAVSMAVAK
AAAEEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQSSFREALR
CGAEIFHALKKILADKGMSTAVGDEGGFAPNFASNEECLNTILSAIEQAGYKAGEDVLLA
LDCAASEFYKDGKYHLEGEGLQLSSEDFANYLANLADKFPIVSIEDGMHESDWAGWKALT
DKLGKKVQLVGDDLFVTNTKILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYT
AVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDIASYPGK
SAFYNLR
Download sequence
Identical sequences A0A0B1YPF7 A0A191ZXG3 B2U9C3 R0EC67
gi|187928065|ref|YP_001898552.1| WP_004626133.1.24508 WP_004626133.1.33042 WP_004626133.1.43321 WP_004626133.1.63793 WP_004626133.1.7297 WP_004626133.1.77303 402626.Rpic_0972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]