SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402626.Rpic_2990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402626.Rpic_2990
Domain Number 1 Region: 95-357
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-75
Family D-glucarate dehydratase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.46e-33
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 402626.Rpic_2990
Sequence length 382
Comment (Ralstonia pickettii 12J)
Sequence
MKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRI
NDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWV
GGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEF
GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSR
FDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVD
FVSWNATLQEQSMGIHYNKGAELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIER
SKEAPDWRNPVWRHADGSVAEW
Download sequence
Identical sequences B2UCA8
WP_012436402.1.43321 WP_012436402.1.7297 gi|187930058|ref|YP_001900545.1| 402626.Rpic_2990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]