SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402626.Rpic_3995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402626.Rpic_3995
Domain Number 1 Region: 448-542
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 
Weak hits

Sequence:  402626.Rpic_3995
Domain Number - Region: 164-271
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 0.0623
Family N-acetylmuramoyl-L-alanine amidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 402626.Rpic_3995
Sequence length 573
Comment (Ralstonia pickettii 12J)
Sequence
MPPSNEHPAAALQHPESFAPLDAPPQPPQQRAVRDVIAGFSIAGLLLPEAVAYAGIASLP
PQAGLIALLCGLVVYSLLGSSRFAIVSATSSSAAVLFATVLSEPGASSATALTMAAALII
ATGVLFILAGAARLGGMSDFIARPVLRGFTFGLALTIAVKQLPKILDVTVHHSDTPRVAL
DLISSAASANPYSTALGAIALALLFGLGRWGRVPATLVVIVLAIAAGYWINWHSYGIAVV
GHIDLQNISFGVPALNRVQWMQSAELGFALMLILYAESYGSIRNFALKHGDGISANRDLV
ALGCANLLSGLLHGMPVGAGYSATSANEAAGAQSRLAGLCAAVVVALIVWLFLPELARIP
EPVLAAIVIFAVSHSLHPAVFKPYWAWHRDRLVVIAALLAVLVLGVLHGLLAAIGVSLLL
TLRKLSEPNVSVLGRLRESHDFVDVSLHPEAKPVPGVLIVRPEVPLFFANTERVLGKVRA
MLQQPHEPALRAIMLSLEETPDVDGSAIEALRVFAAECAARGLQLMLVRLKPRALTVLQR
ATDSTLRAEMLHELSVDECVQSLAATPSTPAGA
Download sequence
Identical sequences B2UHP9 C6BMP9
gi|187926182|ref|YP_001892527.1| gi|241665670|ref|YP_002984029.1| 402626.Rpic_3995 428406.Rpic12D_4108 WP_012430118.1.43321 WP_012430118.1.7259 WP_012430118.1.7297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]