SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402626.Rpic_4449 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402626.Rpic_4449
Domain Number 1 Region: 162-439
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.69e-80
Family D-glucarate dehydratase-like 0.0000000025
Further Details:      
 
Domain Number 2 Region: 14-160
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.19e-26
Family Enolase N-terminal domain-like 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 402626.Rpic_4449
Sequence length 469
Comment (Ralstonia pickettii 12J)
Sequence
MTLQSIESGARTHTPRVTEMQVIPVAGRDSMLLNLCGAHAPFFTRNLVILKDNAGRTGVG
EVPGGEGIRQALERVIPLVVGQSIGRTNGVLSSIRRALAGGGNAAHQATVHQVTSASEAA
VLRQPHEINLRMDNVITAVEAALLDLLGQFLEVPVAELLGAGQQRDSAPMLAYLFYVGDR
RKTDLPYLEGANGADDWLRLRHEAAMTPAAIARLAEAATERYGFADFKLKGGVMPGAEEM
EAIAAIKARFPHARVTLDPNGAWSLNEAIALCKGQGHLVAYAEDPCGPEAGYSGREVMAE
FKRATGIPTATNMIATDWRQMGHAVQLHAVDIPLADPHFWTMQGSVRVAQLCDEWGLTWG
SHSNNHFDVSLAMFTHVAAAAPGNITAIDTHWIWQEAQERLTREPLRIQGGHVAVPERPG
LGIEIDMDRVMAAHALYKTLGPGARDDAMAMQYLVPGWTYDPKRPSLRR
Download sequence
Identical sequences B2UIZ1 C6BP15
gi|187926624|ref|YP_001892969.1| gi|241666136|ref|YP_002984495.1| 402626.Rpic_4449 428406.Rpic12D_4583 WP_012430433.1.43321 WP_012430433.1.7259 WP_012430433.1.7297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]