SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402880.MmarC5_0278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402880.MmarC5_0278
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 402880.MmarC5_0278
Sequence length 177
Comment (Methanococcus maripaludis C5)
Sequence
MRKEIRFSGFGGQGIILAGVILGRAASLYAGKEAVQTQSYGPEARGGASKSEVVISEIEI
DFPKVIQPDILISMSQPAFDKYGYDLKENARVIVDRDLVNLPEGYEEKYEVYKVPFTEIA
NKEVGLGIVANIVMLGALTKLSGLVPKEEVEKALLDSIPKGTEKKNLMAFEKGYEYL
Download sequence
Identical sequences A4FWL9
WP_011868049.1.72418 APC66489.0 gi|134045323|ref|YP_001096809.1| 402880.MmarC5_0278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]