SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 402880.MmarC5_1383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402880.MmarC5_1383
Domain Number 1 Region: 86-124
Classification Level Classification E-value
Superfamily UBA-like 0.0000000935
Family TS-N domain 0.064
Further Details:      
 
Weak hits

Sequence:  402880.MmarC5_1383
Domain Number - Region: 38-93
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0382
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 402880.MmarC5_1383
Sequence length 126
Comment (Methanococcus maripaludis C5)
Sequence
MFPGGGKFNPRMMKQMQKMMKDFGMDAEDLKAVKVTIELEDTILVFEKPKVQVMDMLGNK
TYSITGKAKKVAKAEEKIEDVEVKVEVTEEDIEMVSSQCGVSKEEAKKALEEANGDLAEA
ILKLGN
Download sequence
Identical sequences A4FZP7
gi|134046410|ref|YP_001097895.1| 402880.MmarC5_1383 WP_011869132.1.72418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]