SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402881.Plav_0920 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  402881.Plav_0920
Domain Number - Region: 61-96
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000798
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 402881.Plav_0920
Sequence length 238
Comment (Parvibaculum lavamentivorans DS-1)
Sequence
MSDSTHLGLPYLEAAQAQKHVTVNEALRRLDALVQLSIVSRSLATPPDAPEEGARYIVAP
SPTDMWEGRAGKVAAFIDGAWVFFMPGDGWRAWDEEAGELLVRSGGTWNTVGGAGGPTSA
HGATTRMSIVEGDHVLAAGTASTPDFMIPDRGIVLGVTGHVIEAVTGASAWHLGVADDPE
RYGNYIGVAPGSTVIGVSGMPCAYYGATPLLVTAQGAAFTGGKLRLAIHCLELTGPAA
Download sequence
Identical sequences A7HRL0
gi|154251376|ref|YP_001412200.1| WP_012109797.1.7923 402881.Plav_0920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]