SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402881.Plav_1515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402881.Plav_1515
Domain Number 1 Region: 68-246
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.29e-25
Family Crotonase-like 0.068
Further Details:      
 
Domain Number 2 Region: 419-483
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000183
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 402881.Plav_1515
Sequence length 486
Comment (Parvibaculum lavamentivorans DS-1)
Sequence
MAIAAVLWQTGESDENKAGDNPGRSAMPLRLRLFFFTLLAICGAALPLAGQDAVEPAAAE
AEAPLAIVATVTGAIGPATAKQISDAIEAAEEREADVLIIRIDTPGGLVSSTRDIVSDIL
ASEVPVAGYVWPAGGHAASAGTYIVYATNVAAMAPGTNIGAATPVSMGGGGMPGAPEETP
EDGAEKPAPSNDQALAKKATNDAVALITGLAERHGRNAEWAEEAVREGVSIGARAALEQG
VVEIVATDLDDLLAQMDGRETETAAGPRTLRTAGAQIEHVEPGFMTQVLAIISNPNVAFL
LMMIGVYGIIFELSNPGSIGPGILGAICLLLGLYALNELPLDYAGLALILLGIGLMAAEA
FTPAFGALGAGGLIAFIFGSAILIDSDSPEFQLSWWTIGGTGIASAILIAVIIGYALRAM
GRPVVTGKEEMTGAEARVLEWAEGEGWVHVHGERWHARGPLSLAPQSLVRVEEMDGLTLV
VSEARG
Download sequence
Identical sequences A7HTA1
gi|154251967|ref|YP_001412791.1| 402881.Plav_1515 WP_012110420.1.7923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]