SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 402882.Shew185_1706 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402882.Shew185_1706
Domain Number 1 Region: 415-497
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.033
Further Details:      
 
Weak hits

Sequence:  402882.Shew185_1706
Domain Number - Region: 119-211,309-396
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000157
Family Calcium ATPase, transmembrane domain M 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 402882.Shew185_1706
Sequence length 519
Comment (Shewanella baltica OS185)
Sequence
MFDLIRHKTSSHKADVLSGLTVALALIPEAVAFAFVAHVEPMVGLYAAFIMGLITALIGG
RPGMISGATGAMAVVMVSLVVEHGVQYLFAAVVLAGLIQISAGVCKLGKFIRIVPYPVMI
GFVNGLAIVIFLAQLGQFKVKDASGNLVWLPQEPLMLMLGLVALTMAIIYFLPKITTAVP
SSLVAILTVTAIVVGLDLDTRNVLDFLKTMSGNDNATIAGSLPSFAIPSVPFNLETLYII
LPYSCILAAVGLIESLLTLTVIDEMTNTRGRSNKECVGQGLGNITSGFFGAMGGCAMIGQ
SMININSGGRGRLSGITAAIALLIFILFGASFIEIIPLAALVGVMFIVVLGTFEWASFKF
MGKVPKHDAFVIVLVTTVTVFTDLAFAVFVGVIVSALVFAWEHAKHINVTEEQNEQGWKV
YKLNGPLFFGSIANFLELFDPAKDPQDVVIDFKNSRVADHSALEAIDTLAERYVNAGKKL
HLIHLSADCKALLHKAGNLVEVNQLDDPHYKVADDKLDS
Download sequence
Identical sequences 402882.Shew185_1706 gi|153000231|ref|YP_001365912.1| WP_012088882.1.85636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]