SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 402882.Shew185_4302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402882.Shew185_4302
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily GlnB-like 0.000000956
Family Prokaryotic signal transducing protein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 402882.Shew185_4302
Sequence length 101
Comment (Shewanella baltica OS185)
Sequence
MSTEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREHSHFNIKEQVEGYREFC
KFEIMHPAAQQAALLAALALVCKHNPCRYWIMPIYQNGTLS
Download sequence
Identical sequences A0A165KQ78 A9KW25 B8EDN7 F7RIC3 G0AWA5
gi|378710752|ref|YP_005275646.1| gi|153002798|ref|YP_001368479.1| gi|160877543|ref|YP_001556859.1| 399599.Sbal195_4442 402882.Shew185_4302 407976.Sbal223_4247 gi|386326638|ref|YP_006022755.1| gi|217975385|ref|YP_002360136.1| WP_006079422.1.13801 WP_006079422.1.19221 WP_006079422.1.24904 WP_006079422.1.35668 WP_006079422.1.35710 WP_006079422.1.60405 WP_006079422.1.74325 WP_006079422.1.76213 WP_006079422.1.85636 WP_006079422.1.93117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]