SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404380.Gbem_0323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404380.Gbem_0323
Domain Number 1 Region: 76-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000549
Family NfeD domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 404380.Gbem_0323
Sequence length 152
Comment (Geobacter bemidjiensis Bem)
Sequence
MNIVWWHWLTLGLILIGLELIIPSFTIIWFGLGAVIVSIVLASLPSCPLSVQILIWTVAS
ALLTFAWFRFFNTRLDRTKAGSSKGAVIGETGLVIRGAQQYDKGTVKFHLPLMGADEWPC
VADDPLAVGDRVRVVDVEGHVMKVEKIAKGDK
Download sequence
Identical sequences B5EAP5
404380.Gbem_0323 gi|197116723|ref|YP_002137150.1| WP_012528760.1.31571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]