SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_0934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  404589.Anae109_0934
Domain Number - Region: 74-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000222
Family NfeD domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_0934
Sequence length 139
Comment (Anaeromyxobacter Fw109-5)
Sequence
MAWWLWVLVGLALLLVELVTPGGLFALFFGVGALCVAVLAALGVGSVAQWLAFSALSLAL
LATLRRALQDRLQGRHAPVDSLVGEEAVLLADLPPGGEAKAELRGVPWNARAAPGVSLRA
GQRCRVERVEGLVLWIRAD
Download sequence
Identical sequences A7H8U7
404589.Anae109_0934 gi|153003802|ref|YP_001378127.1| WP_011985249.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]