SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_0957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  404589.Anae109_0957
Domain Number - Region: 49-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000131
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_0957
Sequence length 130
Comment (Anaeromyxobacter Fw109-5)
Sequence
MPELPVPTNPLQVADDKYSALLASDADGPRVVFRGTISTVNPAVILNPFVDAVHGELAKL
GQHRVRVDLRELEFCNSSGFKSFIHWIERIGALPDGKRYSLHFLSNPARKWQRTSLLALS
CYGVNSVSME
Download sequence
Identical sequences A7H8X0
WP_011985272.1.20576 gi|153003825|ref|YP_001378150.1| 404589.Anae109_0957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]