SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_1501 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_1501
Domain Number 1 Region: 25-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.02e-28
Family Clp protease, ClpP subunit 0.051
Further Details:      
 
Domain Number 2 Region: 388-449
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000915
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_1501
Sequence length 452
Comment (Anaeromyxobacter Fw109-5)
Sequence
MRRPRSPRLVLAAVAALAAAIALAAPEPAPPPPPAAPRVLTLEIRGPITGGTAEYVAAGL
VRAREGAYAALAIELDTPGGALDATREIVQAMLASPIPTVVWVGPAGARAGSAGVFLTLA
ADVAAMHPTSNIGAAHPVTGSGRDVAEEAGKDMAKKVENDTAAFARSVAAARGRNADWAE
RAVRESVAITAADAVKERVVDFTAAELRLAVEGADGRKVKTTAGERTLRTRGAALEPYEK
TVRQRVLSFLADPNVLAILMLVGTLGIALELYNPGSIAPGVIGAFALFLAFVGMRVIPVN
AGAVILLLVGAGLLVAEAYVTTHGIAAVAGAACLVLGLAFFVDRASPDYRFAPGTLTISP
WIVWPTPVAVALALGFMAWKVAGTRRRPLQLGAPGLIGSAGEALSDIGPAAGEAFVHGEY
WQARSADAIPEGARVRVVSVEGLTVTVVREGA
Download sequence
Identical sequences A7HAG2
gi|153004367|ref|YP_001378692.1| WP_011985814.1.20576 404589.Anae109_1501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]