SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_1891 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_1891
Domain Number 1 Region: 239-503
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.42e-59
Family PFOR Pyr module 0.082
Further Details:      
 
Domain Number 2 Region: 17-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.72e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0089
Further Details:      
 
Domain Number 3 Region: 513-617
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.15e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_1891
Sequence length 621
Comment (Anaeromyxobacter Fw109-5)
Sequence
MSTQVSVAKHKVEQVETVTIRFVGDSGDGMQLTGTEFTRASALAGNDLATFPDYPAEIRA
PAGSLAGVSGYQVNFGSREIHTPGDAPDVLVAMNPAALKTNLADLKPGGMLLVNVGAFTP
GNLEKAGYKTNPLEDAALKQSYKIFPVDMNKLTEMALAGSGLSSKEVARCKNYFALGLMY
WLYSRPIEAQLESIQRKFAKKPEFAAANAAVFKAGHAYGETSEVFFQRYEVPKSKLAPGT
YRSVTGNFATALGFATVARLTGRQVFLGSYPITPATEILQEMSYFKEHGVVTYQAEDEIA
GIGSAIGAAFGGALACTTTSGPGLALKTEMMGLAVITELPLVVVNVQRGGPSTGMPTKTE
QADLLMALFGRHGEAPMPVIAAQSPADCFWAAIEAMKIATKWMTPVLLLTDGYLGNGSEP
FKIPSLDELPKLKVSYQTSPNYADGTQYMPYLRDDKLVRPWAIPGTPGLEHRVGGLEKDS
LSGMVSYDGMNHERMVKTRAQKIRNVVEDVPDVETFGAASGDLLLVSWGGTFGAVRGAAE
ELQARGKAVGHVHLRWLNPLPKNLGEVLKGFKKVFVPEVNDGQLAFYLRGKFPGVDPLQF
NRINGKPIKISELVGKVLEVL
Download sequence
Identical sequences A7HBJ8
WP_012096672.1.20576 404589.Anae109_1891 gi|153004753|ref|YP_001379078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]